PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0080600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 421aa    MW: 45584.9 Da    PI: 8.2257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0080600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l++ ++++G g+W+++++  g+ R++k+c++rw +yl
   Spipo3G0080600 14 KGLWSPEEDDKLLRHITKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.22.1e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ +++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   Spipo3G0080600  67 RGAFSQQEENRIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.344961IPR017930Myb domain
SuperFamilySSF466898.07E-2912108IPR009057Homeodomain-like
SMARTSM007176.1E-131363IPR001005SANT/Myb domain
PfamPF002495.1E-151461IPR001005SANT/Myb domain
CDDcd001676.54E-121761No hitNo description
PROSITE profilePS5129424.87962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2565117IPR009057Homeodomain-like
SMARTSM007178.0E-1266114IPR001005SANT/Myb domain
PfamPF002494.6E-1367110IPR001005SANT/Myb domain
CDDcd001677.49E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDDKLLRHIT KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENRIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLKQRG  120
IDPNTHKPLA EVNAGGKVPT DSGKTASGDS CNVAGRTTSA SGNSNPTALV APPERPPADT  180
GGTAMTSARN SAKSLFLDEN APPSGFRLSG SVGYFPLQQF NYVSESCGGE TAASGLSVAP  240
NPLLWLTQKN TRPFDVSPQI NFSSVSNAIP SFSEAMSLRS SISLPPDHAP QGFLGIAGAH  300
FWDGGASSNS SGSSSSLFDG GSGGLFRLPE LAPDRDVMMQ VEPEAEDLKW SDFLHGGLPM  360
SAAVQDQNHH NLYSDLKAES QFGIGGFSSW HQSQQQQHLL QSSEVYDKDF QRLPTAFGQI  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910907.11e-144PREDICTED: myb-related protein B-like
TrEMBLH9XUF21e-128H9XUF2_9MAGN; R2R3-MYB transcription factor MYB2
STRINGGSMUA_Achr1P25120_0011e-120(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.15e-91myb domain protein 61